Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELM, Human

SELM protein emerged as a potential thiol-disulfide bond oxidoreductase that plays a key role in the complex disulfide bond formation process. This highlights the importance of SELM proteins in cellular machinery, actively contributing to the delicate coordination of molecular interactions. SELM Protein, Human is the recombinant human-derived SELM protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

SELM Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/selm-protein-human.html

Purity

91.00

Smiles

ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Molecular Formula

140606 (Gene_ID) Q8WWX9 (A24-L145) (Accession)

Molecular Weight

Approximately 17 kDa.The reducing (R) protein migrate s as 17 kDa in SDS-PAGE may b e due to relative charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPBP1 Protein Vector (Mouse) (pPM-C-HA)
PV190224 500 ng

HSPBP1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Rhesus monkey CD47/MER6 Protein, N-His-Flag
EWG17602 100 μg

Recombinant Rhesus monkey CD47/MER6 Protein, N-His-Flag

Sign In for Pricing
View Details
Vimentin (VIM) chicken polyclonal antibody
CH23010-100 100 µL

Vimentin (VIM) chicken polyclonal antibody

Sign In for Pricing
View Details
Tmem167b-set siRNA/shRNA/RNAi Lentivector (Rat)
46933096 4x 500 ng

Tmem167b-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Dst Mouse qPCR Primer Pair (NM_134448)
MP222021 200 Reactions

Dst Mouse qPCR Primer Pair (NM_134448)

Sign In for Pricing
View Details
ZNF148 sgRNA CRISPR Lentivector (Human) (Target 2)
K2688903 1.0 µg DNA

ZNF148 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details