SELM, Human
SELM protein emerged as a potential thiol-disulfide bond oxidoreductase that plays a key role in the complex disulfide bond formation process. This highlights the importance of SELM proteins in cellular machinery, actively contributing to the delicate coordination of molecular interactions. SELM Protein, Human is the recombinant human-derived SELM protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
SELM Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/selm-protein-human.html
Purity
91.00
Smiles
ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL
Molecular Formula
140606 (Gene_ID) Q8WWX9 (A24-L145) (Accession)
Molecular Weight
Approximately 17 kDa.The reducing (R) protein migrate s as 17 kDa in SDS-PAGE may b e due to relative charge.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Anti-PHYHIPL Antibody Picoband®, PE Conjugate
Mannan-binding lectin serine Protease 2 (MASP2) Rat ELISA Kit
Entactin (NID1) (NM_002508) Human Recombinant Protein
Gm4027 sgRNA CRISPR Lentivector (Mouse) (Target 3)
