Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A6 Rabbit Polyclonal Antibody (HRP)

UGT1A6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GNT1, UGT1, HLUGP, UDPGT, UGT1A, UGT1C, UGT1E, UGT1F, HLUGP1, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A1, UGT1A3, UGT1A5, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1A6S, hUG-BR1, UDPGT 1-6

UniProt

P19224

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UGT1A6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_001063

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD16b/FCGR3B Nanobody (SAA1310)
PTX18902-100 100 µg

Anti-Human CD16b/FCGR3B Nanobody (SAA1310)

Sign In for Pricing
View Details
Rat anti-perinuclear factor (APF) ELISA Kit
MBS264155-01 48 Well

Rat anti-perinuclear factor (APF) ELISA Kit

Sign In for Pricing
View Details
Rat anti-perinuclear factor (APF) ELISA Kit
MBS264155-02 96 Well

Rat anti-perinuclear factor (APF) ELISA Kit

Sign In for Pricing
View Details
Rat anti-perinuclear factor (APF) ELISA Kit
MBS264155-03 5x 96 Well

Rat anti-perinuclear factor (APF) ELISA Kit

Sign In for Pricing
View Details
Rat anti-perinuclear factor (APF) ELISA Kit
MBS264155-04 10x 96 Well

Rat anti-perinuclear factor (APF) ELISA Kit

Sign In for Pricing
View Details
Bovine Guanine Nucleotide-Binding Protein Subunit Beta-5 (GNB5) ELISA Kit
MBS9931701-01 48 Well

Bovine Guanine Nucleotide-Binding Protein Subunit Beta-5 (GNB5) ELISA Kit

Sign In for Pricing
View Details