Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPS2 Rabbit Polyclonal Antibody (FITC)

PRPS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PRSII

UniProt

P11908

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRPS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human F10 shRNA (UAS) - Lentiviral human F10 shRNA (UAS, RFP) plasmid
GTR15101317 1 Vial

Lentiviral human F10 shRNA (UAS) - Lentiviral human F10 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
SIG12 rabbit pAb Antibody
orb2303833-01 50 µL

SIG12 rabbit pAb Antibody

Sign In for Pricing
View Details
SIG12 rabbit pAb Antibody
orb2303833-02 100 µL

SIG12 rabbit pAb Antibody

Sign In for Pricing
View Details
MTOR (Mammalian Target of Rapamycin) Porcine ELISA Kit
F1174 96 Tests

MTOR (Mammalian Target of Rapamycin) Porcine ELISA Kit

Sign In for Pricing
View Details
PRELID1, NT (PRELID1, PRELI, PRELI domain-containing protein 1, mitochondrial, 25kD protein of relevant evolutionary and lymphoid interest, Px19-like protein) (APC) discontinued
040422-APC 200 µL

PRELID1, NT (PRELID1, PRELI, PRELI domain-containing protein 1, mitochondrial, 25kD protein of relevant evolutionary and lymphoid interest, Px19-like protein) (APC) discontinued

Sign In for Pricing
View Details
Olfr1226 Protein Vector (Mouse) (pPM-C-HA)
PV208612 500 ng

Olfr1226 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details