Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A1 Rabbit Polyclonal Antibody (Biotin)

SLC22A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OCT1, HOCT1, oct1_cds

UniProt

Q9NQD4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003048

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FADS1 (Fatty Acid Desaturase 1, Delta (5) Fatty Acid Desaturase, D5D, Delta (5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (MaxLight 405) discontinued
126570-ML405 100 µL

FADS1 (Fatty Acid Desaturase 1, Delta (5) Fatty Acid Desaturase, D5D, Delta (5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human PRSS2 Protein, N-His
HY019012-01 50 µg

Recombinant Human PRSS2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PRSS2 Protein, N-His
HY019012-02 100 µg

Recombinant Human PRSS2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PRSS2 Protein, N-His
HY019012-03 1 mg

Recombinant Human PRSS2 Protein, N-His

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Neuropilin 2 (NRP2)
MBS2135864-01 0.1 mL

FITC Linked Monoclonal Antibody to Neuropilin 2 (NRP2)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Neuropilin 2 (NRP2)
MBS2135864-02 0.2 mL

FITC Linked Monoclonal Antibody to Neuropilin 2 (NRP2)

Sign In for Pricing
View Details