Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A1 Rabbit Polyclonal Antibody (HRP)

SLC22A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OCT1, HOCT1, oct1_cds

UniProt

Q9NQD4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003048

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phalloidin-iFluor® 680 Conjugate
23128-AAT 300 Tests

Phalloidin-iFluor® 680 Conjugate

Sign In for Pricing
View Details
Pimavanserin N-Oxide
TRC-P441805-50MG 50 mg

Pimavanserin N-Oxide

Sign In for Pricing
View Details
KPNB1 Recombinant Rabbit Monoclonal Antibody [PSH01-59]
HA721702 100 µL

KPNB1 Recombinant Rabbit Monoclonal Antibody [PSH01-59]

Sign In for Pricing
View Details
RTF2 Human Gene Knockout Kit (CRISPR)
KN401652 1 Kit

RTF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Amyloid beta (1-42 specific) Mouse Monoclonal Antibody [Clone ID: CA9 3B3]
AM26393PU-L 500 µg

Amyloid beta (1-42 specific) Mouse Monoclonal Antibody [Clone ID: CA9 3B3]

Sign In for Pricing
View Details
Ssxb10 Mouse Gene Knockout Kit (CRISPR)
KN516787 1 Kit

Ssxb10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details