Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xpnpep2 Rabbit Polyclonal Antibody (HRP)

Xpnpep2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

M, mAPP, 9030008G12Rik

UniProt

B1AVD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_573476

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTSE1 Rabbit Polyclonal Antibody
TA367587 100 µL

GTSE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant FABP4/ALBP/A-FABP Monoclonal Antibody
AN300248P-01 20 µL

Recombinant FABP4/ALBP/A-FABP Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant FABP4/ALBP/A-FABP Monoclonal Antibody
AN300248P-02 100 µL

Recombinant FABP4/ALBP/A-FABP Monoclonal Antibody

Sign In for Pricing
View Details
EFTUD2 Recombinant Mouse monoclonal Antibody
HA610094 100 µg

EFTUD2 Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
beta Arrestin 1 (ARRB1) Mouse Monoclonal Antibody [Clone ID: OTI2B3]
TA812546S 30 µL

beta Arrestin 1 (ARRB1) Mouse Monoclonal Antibody [Clone ID: OTI2B3]

Sign In for Pricing
View Details
Sitafloxacin Sesquihydrate
TRC-S490920-50MG 50 mg

Sitafloxacin Sesquihydrate

Sign In for Pricing
View Details