Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adamts4 Rabbit Polyclonal Antibody (HRP)

Adamts4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9ESP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASLLPLAWSASPLPREEEIVFPEKLNGSSIIPGSGVPARLLYRLPAFGEI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_076449

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrophenyl Phosphorodichloridate
TRC-N504535-1G 1 g

4-Nitrophenyl Phosphorodichloridate

Sign In for Pricing
View Details
Uncoated Human SELP (P-Selectin) ELISA Kit
E-UNEL-H0157-01 5x 96 Tests

Uncoated Human SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SELP (P-Selectin) ELISA Kit
E-UNEL-H0157-02 15x 96 Tests

Uncoated Human SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human MUC5AC protein (TRX, His tag)
PDEH100792-01 20 µg

Recombinant Human MUC5AC protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Human MUC5AC protein (TRX, His tag)
PDEH100792-02 100 µg

Recombinant Human MUC5AC protein (TRX, His tag)

Sign In for Pricing
View Details
Recombinant Human MUC5AC protein (TRX, His tag)
PDEH100792-03 500 µg

Recombinant Human MUC5AC protein (TRX, His tag)

Sign In for Pricing
View Details