Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cox6a1 Rabbit Polyclonal Antibody (HRP)

Cox6a1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

VIaL

UniProt

Q9DCW5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLKSRHEEHERPPFVAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031774

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (BA17), 0.2mg/mL
BNUB0666-100 1x 100 µL

Cytokeratin 19 (BA17), 0.2mg/mL

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057L-01 20 Tests

Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057L-02 100 Tests

Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF640R conjugate, 0.1mg/mL
BNC402748-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSD17B13 Polyclonal Antibody
E-AB-15110-01 20 µL

HSD17B13 Polyclonal Antibody

Sign In for Pricing
View Details