Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCS2 Rabbit Polyclonal Antibody (FITC)

HMGCS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

P54868

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HMGCS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody
orb1289916-01 30 µL

Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody
orb1289916-02 50 μL

Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody
orb1289916-03 100 µL

Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody
orb1289916-04 200 µL

Histone H3 (TriMethyl-K27) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human mtRNA polymerase (POLRMT) activation kit by CRISPRa
GA103665 1 Kit

Human mtRNA polymerase (POLRMT) activation kit by CRISPRa

Sign In for Pricing
View Details
DATE INSPECTION LBLS B-500 2027 -DIA 15 Inspection & Calibration Labels
834115 600 Pack (24 Label (s) x 25 Card)

DATE INSPECTION LBLS B-500 2027 -DIA 15 Inspection & Calibration Labels

Sign In for Pricing
View Details