Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KHK Rabbit Polyclonal Antibody (Biotin)

KHK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P50053

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KHK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human

Tested Applications

WB

NCBI Accession Number

NP_006479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPF3 (BC021812) Human Untagged Clone
SC102203 10 µg

DPF3 (BC021812) Human Untagged Clone

Sign In for Pricing
View Details
MUS81 Human Over-expression Lysate
orb1356321 100 µg

MUS81 Human Over-expression Lysate

Sign In for Pricing
View Details
Equine Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit-Sandwich
EK8F395-01 48 Test

Equine Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Equine Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit-Sandwich
EK8F395-02 96 Tests

Equine Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Bottle with Screwcap, Wide Mouth, Square
600614B 40/CS

Bottle with Screwcap, Wide Mouth, Square

Sign In for Pricing
View Details
Mouse Left/Right Determination Factor 1 ELISA Kit
MBS104416-01 48 Well

Mouse Left/Right Determination Factor 1 ELISA Kit

Sign In for Pricing
View Details