Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Masp2 Rabbit Polyclonal Antibody (Biotin)

Masp2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MAS, MAp, MAp19, MASP-2

UniProt

Q91WP0

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001003893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2B Protein Vector (Mouse) (pPB-N-His)
PV200167 500 ng

MEF2B Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
2- (((3- (phenylmethoxy) phenyl) amino) ethylidene) indane-1,3-dione
ZQB37529 250 mg

2- (((3- (phenylmethoxy) phenyl) amino) ethylidene) indane-1,3-dione

Sign In for Pricing
View Details
Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein
abx168871-01 10 µg

Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein

Sign In for Pricing
View Details
Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein
abx168871-02 50 µg

Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein

Sign In for Pricing
View Details
Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein
abx168871-03 100 µg

Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein

Sign In for Pricing
View Details
Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein
abx168871-04 200 µg

Human Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Protein

Sign In for Pricing
View Details