Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDS Rabbit Polyclonal Antibody (HRP)

SDS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SDH

UniProt

P20132

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SDS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006834

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR10 Double Nickase Plasmid (m)
sc-432613-NIC 20 µg

GPR10 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
ELISA Kit For Four and a half LIM domains protein 1
E14495h 96 Tests

ELISA Kit For Four and a half LIM domains protein 1

Sign In for Pricing
View Details
Recombinant Leptothrix cholodnii Large-conductance mechanosensitive channel (mscL)
MBS7021166-01 0.02 mg

Recombinant Leptothrix cholodnii Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Leptothrix cholodnii Large-conductance mechanosensitive channel (mscL)
MBS7021166-02 0.1 mg

Recombinant Leptothrix cholodnii Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Leptothrix cholodnii Large-conductance mechanosensitive channel (mscL)
MBS7021166-03 5x 0.1 mg

Recombinant Leptothrix cholodnii Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Human Testis-expressed sequence 2 protein (TEX2) ELISA Kit
abx549356 96 Tests

Human Testis-expressed sequence 2 protein (TEX2) ELISA Kit

Sign In for Pricing
View Details