Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VSIG4 Rabbit Polyclonal Antibody (HRP)

VSIG4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CRIg, Z39IG

UniProt

Q9Y279

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human VSIG4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009199

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)
TMPY-02655-01 5 µg

Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)

Sign In for Pricing
View Details
Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)
TMPY-02655-02 10 µg

Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)

Sign In for Pricing
View Details
Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)
TMPY-02655-03 20 µg

Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)

Sign In for Pricing
View Details
Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)
TMPY-02655-04 50 µg

Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)

Sign In for Pricing
View Details
Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)
TMPY-02655-05 100 µg

Influenza A H10N9 (A/duck/Hong Kong/562/1979) Hemagglutinin/HA1 Protein (His)

Sign In for Pricing
View Details
CASC5 (Protein CASC5, ALL1-fused gene from Chromosome 15q14 Protein, AF15q14, Bub-linking Kinetochore Protein, Blinkin, Cancer Susceptibility Candidate gene 5 Protein, Cancer/Testis antigen 29, CT29, Kinetochore-null Protein 1, Protein D40/AF15q14, CASC5, KIAA1570, KNL1) (FITC) discontinued
302320-FITC 200 µL

CASC5 (Protein CASC5, ALL1-fused gene from Chromosome 15q14 Protein, AF15q14, Bub-linking Kinetochore Protein, Blinkin, Cancer Susceptibility Candidate gene 5 Protein, Cancer/Testis antigen 29, CT29, Kinetochore-null Protein 1, Protein D40/AF15q14, CASC5, KIAA1570, KNL1) (FITC) discontinued

Sign In for Pricing
View Details