Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMPX Rabbit Polyclonal Antibody (Biotin)

SMPX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Csl, DFN6, DFNX4, Chisel

UniProt

B1AWX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMPX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ERRFI1 Protein
E30P6205 20 µg

Recombinant Human ERRFI1 Protein

Sign In for Pricing
View Details
CD50 (ICAMR, Intercellular adhesion molecule 3 (ICAM3)) (PE)
MBS6122818-01 0.1 mL

CD50 (ICAMR, Intercellular adhesion molecule 3 (ICAM3)) (PE)

Sign In for Pricing
View Details
CD50 (ICAMR, Intercellular adhesion molecule 3 (ICAM3)) (PE)
MBS6122818-02 5x 0.1 mL

CD50 (ICAMR, Intercellular adhesion molecule 3 (ICAM3)) (PE)

Sign In for Pricing
View Details
THSD1 Protein Vector (Mouse) (pPM-C-HA)
PV238200 500 ng

THSD1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Ccl22 (NM_009137) Mouse Tagged ORF Clone
MG200244 10 µg

Ccl22 (NM_009137) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Dnajc5b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3171508 1.0 µg DNA

Dnajc5b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details