Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMPX Rabbit Polyclonal Antibody (FITC)

SMPX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Csl, DFN6, DFNX4, Chisel

UniProt

B1AWX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMPX

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cardiac Troponin T (cTnT) Elisa Kit
EK711747 96 Well

Human cardiac Troponin T (cTnT) Elisa Kit

Sign In for Pricing
View Details
Lentiviral mouse Rps21 shRNA (UAS) - Lentiviral mouse Rps21 shRNA (UAS) (25)
GTR15139313 1 Vial

Lentiviral mouse Rps21 shRNA (UAS) - Lentiviral mouse Rps21 shRNA (UAS) (25)

Sign In for Pricing
View Details
pT7-EGFP-dfrA1-6×His Plasmid
PVT61811 2 µg

pT7-EGFP-dfrA1-6×His Plasmid

Sign In for Pricing
View Details
IL27R Polyclonal Antibody, HRP Conjugated
bs-2711R-HRP-01 20 µL

IL27R Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
IL27R Polyclonal Antibody, HRP Conjugated
bs-2711R-HRP-02 100 µL

IL27R Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Sodium Molybdate Dihydrate 98% Extrapure
245300250 250 mg

Sodium Molybdate Dihydrate 98% Extrapure

Sign In for Pricing
View Details