Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMPX Rabbit Polyclonal Antibody (HRP)

SMPX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Csl, DFN6, DFNX4, Chisel

UniProt

B1AWX2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SMPX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Lymph Node Metastasis TCC Cell Line (KU-CTCC-001-LM3)
T8167 1x106 cells / 1.0 mL

Canine Lymph Node Metastasis TCC Cell Line (KU-CTCC-001-LM3)

Sign In for Pricing
View Details
CHM Rabbit Polyclonal Antibody (Cy3)
orb2610351 100 µg

CHM Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Chicken Toll-like receptor 1α (TLR1α) ELISA Kit
YP-W69339-01 48 Tests

Chicken Toll-like receptor 1α (TLR1α) ELISA Kit

Sign In for Pricing
View Details
Chicken Toll-like receptor 1α (TLR1α) ELISA Kit
YP-W69339-02 96 Tests

Chicken Toll-like receptor 1α (TLR1α) ELISA Kit

Sign In for Pricing
View Details
3-Bromo-1-methyl-5-nitropyridin-2 (1H) -one
RAA09821-01 250 mg

3-Bromo-1-methyl-5-nitropyridin-2 (1H) -one

Sign In for Pricing
View Details
3-Bromo-1-methyl-5-nitropyridin-2 (1H) -one
RAA09821-02 2.5 g

3-Bromo-1-methyl-5-nitropyridin-2 (1H) -one

Sign In for Pricing
View Details