Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspb7 Rabbit Polyclonal Antibody (HRP)

Hspb7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cv, 27kDa, Hsp25, cvHsp, Hsp25-2

UniProt

P35385

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRNPHTEHVQQTFRTEIKI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccna2 Mouse Pre-designed siRNA Set A
HY-RS18168 1 Set

Ccna2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Naloxone Impurity 39
RM-N011367-01 10 mg

Naloxone Impurity 39

Sign In for Pricing
View Details
Naloxone Impurity 39
RM-N011367-02 100 mg

Naloxone Impurity 39

Sign In for Pricing
View Details
Naloxone Impurity 39
RM-N011367-03 25 mg

Naloxone Impurity 39

Sign In for Pricing
View Details
Naloxone Impurity 39
RM-N011367-04 50 mg

Naloxone Impurity 39

Sign In for Pricing
View Details
SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)
MBS6347288-01 0.2 mL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)

Sign In for Pricing
View Details