Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DESI2 Rabbit Polyclonal Antibody (FITC)

DESI2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DESI, DESI1, DeSI-2, PNAS-4, PPPDE1, CGI-146, FAM152A, C1orf121

UniProt

Q9BSY9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DESI2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit IgG (H&L) Antibody Alkaline Phosphatase Conjugated Pre-Adsorbed
TA397948 1 mg

Rabbit IgG (H&L) Antibody Alkaline Phosphatase Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
Camel Embryonic Ectoderm Development ELISA Kit
MBS078214-01 48 Well

Camel Embryonic Ectoderm Development ELISA Kit

Sign In for Pricing
View Details
Camel Embryonic Ectoderm Development ELISA Kit
MBS078214-02 96 Well

Camel Embryonic Ectoderm Development ELISA Kit

Sign In for Pricing
View Details
Camel Embryonic Ectoderm Development ELISA Kit
MBS078214-03 5x 96 Well

Camel Embryonic Ectoderm Development ELISA Kit

Sign In for Pricing
View Details
Camel Embryonic Ectoderm Development ELISA Kit
MBS078214-04 10x 96 Well

Camel Embryonic Ectoderm Development ELISA Kit

Sign In for Pricing
View Details
TMPRSS9 Antibody
orb1268620 400 μl

TMPRSS9 Antibody

Sign In for Pricing
View Details