Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST7 Rabbit Polyclonal Antibody (HRP)

CHST7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GST-5, C6ST-2

UniProt

Q9NS84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHST7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_063939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF366264 (NM_153093) Mouse Tagged Lenti ORF Clone
MR215245L3 10 µg

AF366264 (NM_153093) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Anti Human PROK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 120UL
IRBAMLPROK2AP08120UL 120 µL

Rabbit Anti Human PROK2 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 120UL

Sign In for Pricing
View Details
PARP (214, 215) Cleavage Site (MaxLight 550) discontinued
P3113-03A-ML550 100 µL

PARP (214, 215) Cleavage Site (MaxLight 550) discontinued

Sign In for Pricing
View Details
BAD, Phosphorylated (S34) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 405)
MBS6277388-01 0.1 mL

BAD, Phosphorylated (S34) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 405)

Sign In for Pricing
View Details
BAD, Phosphorylated (S34) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 405)
MBS6277388-02 5x 0.1 mL

BAD, Phosphorylated (S34) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 405)

Sign In for Pricing
View Details
Gm525 (NM_001033266) Mouse Tagged Lenti ORF Clone
MR214401L4 10 µg

Gm525 (NM_001033266) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details