Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHST7 Rabbit Polyclonal Antibody (HRP)

CHST7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GST-5, C6ST-2

UniProt

Q9NS84

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHST7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_063939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPAN3 (NM_001168412) Human Over-expression Lysate
E45H00614-2 20 µg

TSPAN3 (NM_001168412) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human HN-1/ ARM2 Protein, His-SUMO, E.coli-500ug
QP8233-ec-500ug 500ug

Recombinant Human HN-1/ ARM2 Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
PIC 656-TRI 100-B7525 AC Signs
223505 Card of 1 Pictogram(s)

PIC 656-TRI 100-B7525 AC Signs

Sign In for Pricing
View Details
mmu-miR-369-5p miRNA Inhibitor
MBS8295639-01 10 nmol

mmu-miR-369-5p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-369-5p miRNA Inhibitor
MBS8295639-02 20 nmol

mmu-miR-369-5p miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-369-5p miRNA Inhibitor
MBS8295639-03 5x 20 nmol

mmu-miR-369-5p miRNA Inhibitor

Sign In for Pricing
View Details