Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcdh10 Rabbit Polyclonal Antibody (FITC)

Pcdh10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OL, OL-pc, mKIAA1400, 6430521D13Rik, 6430703F07Rik

UniProt

E9PXQ7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSDGRQAADYRSNLHVPGMDSVPDTEVFEPPEVQPGAERSFSTFGKEKAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001091640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EG622640 (m) -PR
sc-143844-PR 10 µM - 20 µL

EG622640 (m) -PR

Sign In for Pricing
View Details
GGPS1 Rabbit Polyclonal Antibody (HRP)
orb2114261 100 µL

GGPS1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Aluminum housed, round bottom mantle for spherical flask 22000ml, 2 circuits 770W each, 230V
100C M119 1 Each

Aluminum housed, round bottom mantle for spherical flask 22000ml, 2 circuits 770W each, 230V

Sign In for Pricing
View Details
ASAH1 (NM_004315) Human Tagged Lenti ORF Clone
RC212434L3 10 µg

ASAH1 (NM_004315) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit anti-CD192 Antibody
YLD1420-01 50 µL

Rabbit anti-CD192 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD192 Antibody
YLD1420-02 100 µL

Rabbit anti-CD192 Antibody

Sign In for Pricing
View Details