Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pcdh10 Rabbit Polyclonal Antibody (HRP)

Pcdh10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OL, OL-pc, mKIAA1400, 6430521D13Rik, 6430703F07Rik

UniProt

E9PXQ7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSDGRQAADYRSNLHVPGMDSVPDTEVFEPPEVQPGAERSFSTFGKEKAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001091640

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/XFD700 Anti-human CD1 Antibody *SN13*
100121O0-AAT 25 Tests

PE/XFD700 Anti-human CD1 Antibody *SN13*

Sign In for Pricing
View Details
Rabbit Polyclonal AMIGO Antibody [DyLight 755]
NBP2-81780IR 0.1 mL

Rabbit Polyclonal AMIGO Antibody [DyLight 755]

Sign In for Pricing
View Details
Desmocollin 2 (DSC2) (NM_004949) Human Recombinant Protein
TP322207L 1 mg

Desmocollin 2 (DSC2) (NM_004949) Human Recombinant Protein

Sign In for Pricing
View Details
GSC CRISPRa sgRNA lentivector (set of three targets)(Human)
22719121 3x 1.0µg DNA

GSC CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Proline-rich protein 7 (PRR7) Mouse ELISA Kit
G1845 96 Tests

Proline-rich protein 7 (PRR7) Mouse ELISA Kit

Sign In for Pricing
View Details
Pwwp2a (NM_001127296) Rat Tagged Lenti ORF Clone
RR206305L3 10 µg

Pwwp2a (NM_001127296) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details