Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGTLA4 Rabbit Polyclonal Antibody (Biotin)

GGTLA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GGTL6, GGTLA3, GGTLA4, dJ831C21.1, dJ831C21.2

UniProt

Q9BX51

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GGTLA4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_563577

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKC epsilon Polyclonal Antibody, APC Conjugated
bs-2329R-APC 100 µL

PKC epsilon Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
N15000 Nom Kine/Dyna Viscosity Density Std
REVIS-N15000 500 mL

N15000 Nom Kine/Dyna Viscosity Density Std

Sign In for Pricing
View Details
MOGT1, CT (MOGAT1, DC2, DGAT2L1, 2-acylglycerol O-acyltransferase 1, Acyl-CoA:monoacylglycerol acyltransferase 1, Diacylglycerol O-acyltransferase candidate 2, Diacylglycerol acyltransferase 2-like protein 1, Monoacylglycerol O-acyltransferase 1) (AP)
MBS6321647-01 0.2 mL

MOGT1, CT (MOGAT1, DC2, DGAT2L1, 2-acylglycerol O-acyltransferase 1, Acyl-CoA:monoacylglycerol acyltransferase 1, Diacylglycerol O-acyltransferase candidate 2, Diacylglycerol acyltransferase 2-like protein 1, Monoacylglycerol O-acyltransferase 1) (AP)

Sign In for Pricing
View Details
MOGT1, CT (MOGAT1, DC2, DGAT2L1, 2-acylglycerol O-acyltransferase 1, Acyl-CoA:monoacylglycerol acyltransferase 1, Diacylglycerol O-acyltransferase candidate 2, Diacylglycerol acyltransferase 2-like protein 1, Monoacylglycerol O-acyltransferase 1) (AP)
MBS6321647-02 5x 0.2 mL

MOGT1, CT (MOGAT1, DC2, DGAT2L1, 2-acylglycerol O-acyltransferase 1, Acyl-CoA:monoacylglycerol acyltransferase 1, Diacylglycerol O-acyltransferase candidate 2, Diacylglycerol acyltransferase 2-like protein 1, Monoacylglycerol O-acyltransferase 1) (AP)

Sign In for Pricing
View Details
Mouse anti-Human HLA-DR, Purified mAb
E16HUDR-050 50 Tests

Mouse anti-Human HLA-DR, Purified mAb

Sign In for Pricing
View Details
RPS19 Recombinant Antibody, AbBy Fluor™ 750 Conjugated
bsm-54242R-BF750-01 20 µL

RPS19 Recombinant Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details