Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALAD Rabbit Polyclonal Antibody (Biotin)

ALAD Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PBGS, ALADH

UniProt

P13716

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ALAD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000022

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKBp65, CT (S536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 405)
MBS6325130-01 0.1 mL

NFKBp65, CT (S536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 405)

Sign In for Pricing
View Details
NFKBp65, CT (S536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 405)
MBS6325130-02 5x 0.1 mL

NFKBp65, CT (S536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 405)

Sign In for Pricing
View Details
KBTBD10 Protein Vector (Rat) (pPB-C-His)
PV275542 500 ng

KBTBD10 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Cd93 3'UTR GFP Stable Cell Line
TU153538 1.0 mL

Cd93 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse H3c13 shRNA (UAS) - Lentiviral mouse H3c13 shRNA (UAS, RFP) plasmid
GTR15194737 1 Vial

Lentiviral mouse H3c13 shRNA (UAS) - Lentiviral mouse H3c13 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
LolB Antibody
orb817731 2 mg

LolB Antibody

Sign In for Pricing
View Details