Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAH Rabbit Polyclonal Antibody (HRP)

FAH Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P16930

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calponin-1 (CNN1/832), CF488A conjugate, 0.1mg/mL
BNC880832-500 1x 500 µL

Calponin-1 (CNN1/832), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS626973 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Syntenin (SDCBP) (NM_001007067) Human Over-expression Lysate
LY425198 100 µg

Syntenin (SDCBP) (NM_001007067) Human Over-expression Lysate

Sign In for Pricing
View Details
POU4F3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H9]
TA808755AM 100 µL

POU4F3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6H9]

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF640R conjugate, 0.1mg/mL
BNC402474-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LOC100289561 activation kit by CRISPRa
GA119246 1 Kit

Human LOC100289561 activation kit by CRISPRa

Sign In for Pricing
View Details