Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAH Rabbit Polyclonal Antibody (HRP)

FAH Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P16930

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FAH

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glypican 3 (GPC3) Human Recombinant Protein
TP721281M 100 µg

Glypican 3 (GPC3) Human Recombinant Protein

Sign In for Pricing
View Details
Eukaryotic aspartyl protease Antibody
bs-0613R 100 µL

Eukaryotic aspartyl protease Antibody

Sign In for Pricing
View Details
Anti-Mannan Binding Lectin/MBL2 Antibody, Rabbit Polyclonal
MBS8100363-01 0.1 mL

Anti-Mannan Binding Lectin/MBL2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Mannan Binding Lectin/MBL2 Antibody, Rabbit Polyclonal
MBS8100363-02 5x 0.1 mL

Anti-Mannan Binding Lectin/MBL2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
FOXF1 Polyclonal Antibody
MBS9237608-01 0.1 mL

FOXF1 Polyclonal Antibody

Sign In for Pricing
View Details
FOXF1 Polyclonal Antibody
MBS9237608-02 5x 0.1 mL

FOXF1 Polyclonal Antibody

Sign In for Pricing
View Details