Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FECH Rabbit Polyclonal Antibody (FITC)

FECH Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EPP, FCE, EPP1

UniProt

Q8NAN0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FECH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001012533

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R8 (Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, ARD1, ARD-1, Nuclear Inhibitor of Protein Phosphatase 1, NIPP1, NIPP-1, PRO2047) (AP)
MBS6432612-01 0.1 mL

PPP1R8 (Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, ARD1, ARD-1, Nuclear Inhibitor of Protein Phosphatase 1, NIPP1, NIPP-1, PRO2047) (AP)

Sign In for Pricing
View Details
PPP1R8 (Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, ARD1, ARD-1, Nuclear Inhibitor of Protein Phosphatase 1, NIPP1, NIPP-1, PRO2047) (AP)
MBS6432612-02 5x 0.1 mL

PPP1R8 (Protein Phosphatase 1 Regulatory Inhibitor Subunit 8, ARD1, ARD-1, Nuclear Inhibitor of Protein Phosphatase 1, NIPP1, NIPP-1, PRO2047) (AP)

Sign In for Pricing
View Details
Lentiviral mouse Slc47a2 shRNA (UAS) - Lentiviral mouse Slc47a2 shRNA (UAS) (100)
GTR15234306 1 Vial

Lentiviral mouse Slc47a2 shRNA (UAS) - Lentiviral mouse Slc47a2 shRNA (UAS) (100)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to CREB Binding Protein (CREBBP)
MBS2073827-01 0.1 mL

PE-Linked Polyclonal Antibody to CREB Binding Protein (CREBBP)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to CREB Binding Protein (CREBBP)
MBS2073827-02 0.2 mL

PE-Linked Polyclonal Antibody to CREB Binding Protein (CREBBP)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to CREB Binding Protein (CREBBP)
MBS2073827-03 0.5 mL

PE-Linked Polyclonal Antibody to CREB Binding Protein (CREBBP)

Sign In for Pricing
View Details