Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAMT Rabbit Polyclonal Antibody (HRP)

GAMT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PIG2, CCDS2, TP53I2, HEL-S-20

UniProt

Q14353

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GAMT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_000147

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTOV1 Rabbit Polyclonal Antibody (Fluoro550)
orb3074348 100 µg

PTOV1 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Grik4 3'UTR Luciferase Stable Cell Line
TU109110 1.0 mL

Grik4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Glypican 4 (GPC4) ELISA Kit
MBS2702794-01 24 Strip Well

Mouse Glypican 4 (GPC4) ELISA Kit

Sign In for Pricing
View Details
Mouse Glypican 4 (GPC4) ELISA Kit
MBS2702794-02 48 Well

Mouse Glypican 4 (GPC4) ELISA Kit

Sign In for Pricing
View Details
Mouse Glypican 4 (GPC4) ELISA Kit
MBS2702794-03 96 Well

Mouse Glypican 4 (GPC4) ELISA Kit

Sign In for Pricing
View Details
Mouse Glypican 4 (GPC4) ELISA Kit
MBS2702794-04 5x 96 Well

Mouse Glypican 4 (GPC4) ELISA Kit

Sign In for Pricing
View Details