Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCL Rabbit Polyclonal Antibody (Biotin)

HMGCL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HL

UniProt

P35914

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BIBR 1532
S1186-50mg 50 mg

BIBR 1532

Sign In for Pricing
View Details
ZNF607, ID (ZNF607, Zinc finger protein 607) (MaxLight 750) discontinued
044303-ML750 100 µL

ZNF607, ID (ZNF607, Zinc finger protein 607) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Lentiviral human ZNF814 sgRNA gene knockout kit - Lentiviral human ZNF814 sgRNA gene knockout kit (25)
GTR15379746 1 Vial

Lentiviral human ZNF814 sgRNA gene knockout kit - Lentiviral human ZNF814 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Proteasome 20S β5 subunit (human) polyclonal antibody
BML-PW8895-0025 25 µL

Proteasome 20S β5 subunit (human) polyclonal antibody

Sign In for Pricing
View Details
FTLP7 ORF Vector (Human) (pORF)
ORF019918 1.0 µg DNA

FTLP7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Monkey Serine Protease Inhibitor Kazal Type 1 (SPINK1) ELISA Kit
MBS101562-01 48 Well

Monkey Serine Protease Inhibitor Kazal Type 1 (SPINK1) ELISA Kit

Sign In for Pricing
View Details