Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCL Rabbit Polyclonal Antibody (HRP)

HMGCL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HL

UniProt

P35914

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)
MBS2099046-01 5x 96 Tests

Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)
MBS2099046-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)
MBS2099046-03 10x 96 Tests

Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)
MBS2099046-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Keratin 14 (KRT14) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
RGD1565928 3'UTR Luciferase Stable Cell Line
TU219264 1.0 mL

RGD1565928 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
KRAB4 CRISPR Activation Plasmid (m)
sc-431316-ACT 20 µg

KRAB4 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details