Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGCL Rabbit Polyclonal Antibody (Biotin)

HMGCL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HL

UniProt

P35914

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HMGCL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000182

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPREB3 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2531225 100 µL

VPREB3 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (MaxLight 550)
MBS6500762-01 0.1 mL

SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (MaxLight 550)

Sign In for Pricing
View Details
SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (MaxLight 550)
MBS6500762-02 5x 0.1 mL

SRPK2, CT (Serine/Threonine-protein Kinase SRPK2, Serine/Arginine-rich Protein-specific Kinase 2, SR-protein-specific Kinase 2, SFRS Protein Kinase 2) (MaxLight 550)

Sign In for Pricing
View Details
Zfp790 Protein Vector (Mouse) (pPM-C-His)
PV250269 500 ng

Zfp790 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-222-5p-Off Virus
mh5357 1.0 mL

AdmiRa-hsa-miR-222-5p-Off Virus

Sign In for Pricing
View Details
Lentiviral mouse Ssxb9 shRNA (UAS) - Lentiviral mouse Ssxb9 shRNA (UAS, GFP) (100)
GTR15228561 1 Vial

Lentiviral mouse Ssxb9 shRNA (UAS) - Lentiviral mouse Ssxb9 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details