Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LCAT Rabbit Polyclonal Antibody (HRP)

LCAT Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P04180

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LCAT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Volumetric Sol Potassium Permanganate 0.02M (0.1N)
PP2002F-01 100 mL

Volumetric Sol Potassium Permanganate 0.02M (0.1N)

Sign In for Pricing
View Details
Volumetric Sol Potassium Permanganate 0.02M (0.1N)
PP2002F-02 1 L

Volumetric Sol Potassium Permanganate 0.02M (0.1N)

Sign In for Pricing
View Details
Volumetric Sol Potassium Permanganate 0.02M (0.1N)
PP2002F-03 2.5 L

Volumetric Sol Potassium Permanganate 0.02M (0.1N)

Sign In for Pricing
View Details
CYB561D1, CT (CYB561D1, Cytochrome b561 domain-containing protein 1) (MaxLight 490) discontinued
034402-ML490 100 µL

CYB561D1, CT (CYB561D1, Cytochrome b561 domain-containing protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human GRXCR1 Pre-designed siRNA Set B
SI006669B 1 Each

Human GRXCR1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Goat anti Human IgG (FITC)
43C-CB0973 2 mg

Goat anti Human IgG (FITC)

Sign In for Pricing
View Details