Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHAG Rabbit Polyclonal Antibody (FITC)

RHAG Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OHS, RH2, OHST, RHNR, Rh50, CD241, RH50A, Rh50GP, SLC42A1

UniProt

Q02094

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RHAG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000315

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB (LN-3 + HLA-DRB/1067), CF568 conjugate, 0.1mg/mL
BNC681208-500 1x 500 µL

HLA-DRB (LN-3 + HLA-DRB/1067), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1059), Biotin conjugate, 0.1mg/mL
BNCB1059-500 1x 500 µL

CD71 (TFRC/1059), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human CEACAM5/CEA Protein (Fc Tag)
PKSH032237-01 10 µg

Recombinant Human CEACAM5/CEA Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CEACAM5/CEA Protein (Fc Tag)
PKSH032237-02 50 µg

Recombinant Human CEACAM5/CEA Protein (Fc Tag)

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF640R conjugate, 0.1mg/mL
BNC401758-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF740 conjugate, 0.1mg/mL
BNC743775-500 1x 500 µL

IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details