Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IAPP Rabbit Polyclonal Antibody (HRP)

IAPP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DAP, IAP

UniProt

P10997

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IAPP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

4kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_000406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHIP-1, NT (SHIP, SHIP1, hp51CN, INPP5D, SIP-145, Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, SH2 Domain-Containing Inositol-5'-Phosphatase 1, SH2 Domain-Containing Inositol Phosphatase 1, Inositol Polyphosphate-5-Phosphatase Of 145kD, p150Ship) (PE) discontinued
S1013-21C-PE 100 µL

SHIP-1, NT (SHIP, SHIP1, hp51CN, INPP5D, SIP-145, Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, SH2 Domain-Containing Inositol-5'-Phosphatase 1, SH2 Domain-Containing Inositol Phosphatase 1, Inositol Polyphosphate-5-Phosphatase Of 145kD, p150Ship) (PE) discontinued

Sign In for Pricing
View Details
AGO2/Argonaute-2, Mouse (sf9, His)
HY-P74423-01 10 µg

AGO2/Argonaute-2, Mouse (sf9, His)

Sign In for Pricing
View Details
AGO2/Argonaute-2, Mouse (sf9, His)
HY-P74423-02 20 µg

AGO2/Argonaute-2, Mouse (sf9, His)

Sign In for Pricing
View Details
AGO2/Argonaute-2, Mouse (sf9, His)
HY-P74423-03 50 µg

AGO2/Argonaute-2, Mouse (sf9, His)

Sign In for Pricing
View Details
G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (MaxLight 490)
MBS6300637-01 0.1 mL

G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (MaxLight 490)

Sign In for Pricing
View Details
G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (MaxLight 490)
MBS6300637-02 5x 0.1 mL

G2E3, ID (G2E3, KIAA1333, G2/M phase-specific E3 ubiquitin-protein ligase) (MaxLight 490)

Sign In for Pricing
View Details