Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB4 Rabbit Polyclonal Antibody (HRP)

ABCB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GBD1, ICP3, MDR2, MDR3, PGY3, ABC21, MDR2/3, PFIC-3

UniProt

A4D1D4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABCB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

141kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000434

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAXX (Death Domain-associated Protein 6, Daxx, hDaxx, Fas Death Domain-associated Protein, ETS1 associated Protein 1, EAP1, BING2, DAP6) (AP) discontinued
125640-AP 100 µL

DAXX (Death Domain-associated Protein 6, Daxx, hDaxx, Fas Death Domain-associated Protein, ETS1 associated Protein 1, EAP1, BING2, DAP6) (AP) discontinued

Sign In for Pricing
View Details
Rat Nup35 Pre-designed siRNA Set A
SI209667A 1 Each

Rat Nup35 Pre-designed siRNA Set A

Sign In for Pricing
View Details
SDCCAG8 Recombinant Protein (Rat)
RP227798 100 µg

SDCCAG8 Recombinant Protein (Rat)

Sign In for Pricing
View Details
NR4A2 (Nuclear Receptor Subfamily 4, Group A, Member 2, HZF-3, NOT, NURR1, RNR1, TINUR) (PE)
249481-PE 100 µL

NR4A2 (Nuclear Receptor Subfamily 4, Group A, Member 2, HZF-3, NOT, NURR1, RNR1, TINUR) (PE)

Sign In for Pricing
View Details
BeyoFastTM SmaI
D5905-100μl 100 µL

BeyoFastTM SmaI

Sign In for Pricing
View Details
COL4A2 (P175) polyclonal antibody
orb643530-01 25 µL

COL4A2 (P175) polyclonal antibody

Sign In for Pricing
View Details