Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB4 Rabbit Polyclonal Antibody (FITC)

ABCB4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GBD1, ICP3, MDR2, MDR3, PGY3, ABC21, MDR2/3, PFIC-3

UniProt

P21439

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABCB4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

141kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000434

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endonuclease V (ENDOV) (NM_173627) Human Over-expression Lysate
LS284131 100 µg

Endonuclease V (ENDOV) (NM_173627) Human Over-expression Lysate

Sign In for Pricing
View Details
Raptor (S863) (Regulatory-associated Protein of mTOR, Raptor, P150 Target of Rapamycin (TOR)-scaffold Protein, RPTOR, KIAA1303) (MaxLight 490)
MBS6496937-01 0.1 mL

Raptor (S863) (Regulatory-associated Protein of mTOR, Raptor, P150 Target of Rapamycin (TOR)-scaffold Protein, RPTOR, KIAA1303) (MaxLight 490)

Sign In for Pricing
View Details
Raptor (S863) (Regulatory-associated Protein of mTOR, Raptor, P150 Target of Rapamycin (TOR)-scaffold Protein, RPTOR, KIAA1303) (MaxLight 490)
MBS6496937-02 5x 0.1 mL

Raptor (S863) (Regulatory-associated Protein of mTOR, Raptor, P150 Target of Rapamycin (TOR)-scaffold Protein, RPTOR, KIAA1303) (MaxLight 490)

Sign In for Pricing
View Details
CDCP1 (phospho-Tyr806) rabbit pAb
MBS8599952-01 0.1 mL

CDCP1 (phospho-Tyr806) rabbit pAb

Sign In for Pricing
View Details
CDCP1 (phospho-Tyr806) rabbit pAb
MBS8599952-02 0.1 mL (AF405L)

CDCP1 (phospho-Tyr806) rabbit pAb

Sign In for Pricing
View Details
CDCP1 (phospho-Tyr806) rabbit pAb
MBS8599952-03 0.1 mL (AF405S)

CDCP1 (phospho-Tyr806) rabbit pAb

Sign In for Pricing
View Details