Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCB4 Rabbit Polyclonal Antibody (HRP)

ABCB4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GBD1, ICP3, MDR2, MDR3, PGY3, ABC21, MDR2/3, PFIC-3

UniProt

P21439

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABCB4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

141kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000434

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGAT2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV686664 1.0 µg DNA

MGAT2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Actbl2 Mouse Gene Knockout Kit (CRISPR)
KN500773 1 Kit

Actbl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GMPS Protein Vector (Mouse) (pPM-C-His)
PV185177 500 ng

GMPS Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
SUCNR1 Antibody : Biotin (OAAF05219-Biotin)
OAAF05219-100UG-Biotin 100 µg

SUCNR1 Antibody : Biotin (OAAF05219-Biotin)

Sign In for Pricing
View Details
Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit
orb775991-01 48 Tests

Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit

Sign In for Pricing
View Details
Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit
orb775991-02 96 Tests

Human Procollagen II C-Terminal Propeptide (PIICP) ELISA Kit

Sign In for Pricing
View Details