Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALB Rabbit Polyclonal Antibody (Biotin)

ALB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HSA, PRO0883, PRO0903, PRO1341

UniProt

P02768

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ALB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000468

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc35a4 ORF Vector (Rat) (pORF)
ORF076482 1.0 µg DNA

Slc35a4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
KCNMB3 (Calcium-activated Potassium Channel Subunit beta-3, BK Channel Subunit beta-3, BKbeta3, Hbeta3, Calcium-activated Potassium Channel, Subfamily M Subunit beta-3, Charybdotoxin Receptor Subunit beta-3, K (VCA) beta-3, Maxi K Channel Subunit beta-3, Slo-beta-3, KCNMB2, KCNMBL) (FITC)
128752-FITC 100 µL

KCNMB3 (Calcium-activated Potassium Channel Subunit beta-3, BK Channel Subunit beta-3, BKbeta3, Hbeta3, Calcium-activated Potassium Channel, Subfamily M Subunit beta-3, Charybdotoxin Receptor Subunit beta-3, K (VCA) beta-3, Maxi K Channel Subunit beta-3, Slo-beta-3, KCNMB2, KCNMBL) (FITC)

Sign In for Pricing
View Details
Microscope Slides Cystopus Asexual VS
4041400/3 1 Each

Microscope Slides Cystopus Asexual VS

Sign In for Pricing
View Details
AdmiRa-Off-hsa-miR-6132 Virus
mh7052 1.0 mL

AdmiRa-Off-hsa-miR-6132 Virus

Sign In for Pricing
View Details
CDK5RAP1 siRNA (Human)
CRH9883-01 15 nmol

CDK5RAP1 siRNA (Human)

Sign In for Pricing
View Details
CDK5RAP1 siRNA (Human)
CRH9883-02 30 nmol

CDK5RAP1 siRNA (Human)

Sign In for Pricing
View Details