Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B2 Rabbit Polyclonal Antibody (HRP)

CYP11B2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-450C18, P450aldo

UniProt

P19099

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_000489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Human CD38 Antibody[HB-7]
AN003490P-01 25 µg

Purified Anti-Human CD38 Antibody[HB-7]

Sign In for Pricing
View Details
Purified Anti-Human CD38 Antibody[HB-7]
AN003490P-02 100 µg

Purified Anti-Human CD38 Antibody[HB-7]

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (rS100A4/1481), CF594 conjugate, 0.1mg/mL
BNC943186-100 1x 100 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (rS100A4/1481), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MEK5 (MAP2K5) Human Gene Knockout Kit (CRISPR)
KN203171LP 1 Kit

MEK5 (MAP2K5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COTL1 Mouse Monoclonal Antibody [Clone ID: AT1D6]
AM50092PU-N 100 µL

COTL1 Mouse Monoclonal Antibody [Clone ID: AT1D6]

Sign In for Pricing
View Details
Geranylgeranyltriphenylphosphonium Bromide
TRC-G367630-10MG 10 mg

Geranylgeranyltriphenylphosphonium Bromide

Sign In for Pricing
View Details