Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP11B2 Rabbit Polyclonal Antibody (HRP)

CYP11B2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CPN2, ALDOS, CYP11B, CYP11BL, CYPXIB2, P450C18, P-450C18, P450aldo

UniProt

P19099

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP11B2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_000489

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Tissue factor/TF protein (His tag)
PDMR100023-01 20 µg

Recombinant Rat Tissue factor/TF protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat Tissue factor/TF protein (His tag)
PDMR100023-02 100 µg

Recombinant Rat Tissue factor/TF protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat Tissue factor/TF protein (His tag)
PDMR100023-03 500 µg

Recombinant Rat Tissue factor/TF protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat Tissue factor/TF protein (His tag)
PDMR100023-04 1 mg

Recombinant Rat Tissue factor/TF protein (His tag)

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR559799 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Calpain 1 (CAPN1/1530), Biotin conjugate, 0.1mg/mL
BNCB1530-500 1x 500 µL

Calpain 1 (CAPN1/1530), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details