Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGA Rabbit Polyclonal Antibody (Biotin)

FGA Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Fib2

UniProt

Q4QQH7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FGA

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_068657

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MMP-7 Antibody (MM0022-4C21) [mFluor Violet 500 SE]
NB110-60988MFV500 0.1 mL

Mouse Monoclonal MMP-7 Antibody (MM0022-4C21) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Lentiviral mouse Clrn3 shRNA (UAS) - Lentiviral mouse Clrn3 shRNA (UAS) plasmid
GTR15208075 1 Vial

Lentiviral mouse Clrn3 shRNA (UAS) - Lentiviral mouse Clrn3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)
MBS2085255-01 0.1 mL

FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)
MBS2085255-02 0.2 mL

FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)
MBS2085255-03 0.5 mL

FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)
MBS2085255-04 1 mL

FITC-Linked Polyclonal Antibody to Coenzyme Q6 Homolog, Monooxygenase (COQ6)

Sign In for Pricing
View Details