Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Rabbit Polyclonal Antibody (FITC)

GSTM1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MU, H-B, GST1, GTH4, GTM1, MU-1, GSTM1-1, GSTM1a-1a, GSTM1b-1b

UniProt

P46439

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCER2 activation kit by CRISPRa
GA118700 1 Kit

Human CCER2 activation kit by CRISPRa

Sign In for Pricing
View Details
EHMT2/G9A (EHMT2) Human Gene Knockout Kit (CRISPR)
KN219200LP 1 Kit

EHMT2/G9A (EHMT2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Cdk6 activation kit by CRISPRa
GA200674 1 Kit

Mouse Cdk6 activation kit by CRISPRa

Sign In for Pricing
View Details
4-tert-Butylbenzenesulfonyl Chloride
TRC-B810840-5G 5 g

4-tert-Butylbenzenesulfonyl Chloride

Sign In for Pricing
View Details
Mitochondrial Marker (MTC02), CF488A conjugate, 0.1mg/mL
BNC880740-500 1x 500 µL

Mitochondrial Marker (MTC02), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ReadiScript™ RT Reverse Transcription Kit
60100-AAT 50 Reactions

ReadiScript™ RT Reverse Transcription Kit

Sign In for Pricing
View Details