Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Rabbit Polyclonal Antibody (HRP)

GSTM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MU, H-B, GST1, GTH4, GTM1, MU-1, GSTM1-1, GSTM1a-1a, GSTM1b-1b

UniProt

P46439

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D2]
TA813335AM 100 µL

alpha 1 Fetoprotein (AFP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D2]

Sign In for Pricing
View Details
MDM2 (SMP14), CF568 conjugate, 0.1mg/mL
BNC681721-500 1x 500 µL

MDM2 (SMP14), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sox18 Mouse Gene Knockout Kit (CRISPR)
KN516494 1 Kit

Sox18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Col5a1 Mouse Gene Knockout Kit (CRISPR)
KN503643 1 Kit

Col5a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cbr3 Mouse Gene Knockout Kit (CRISPR)
KN502605 1 Kit

Cbr3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Complement factor B Antibody
RC-16319-01 50 μL

Recombinant Complement factor B Antibody

Sign In for Pricing
View Details