Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTM1 Rabbit Polyclonal Antibody (HRP)

GSTM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MU, H-B, GST1, GTH4, GTM1, MU-1, GSTM1-1, GSTM1a-1a, GSTM1b-1b

UniProt

P46439

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_000552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trem3 Mouse Gene Knockout Kit (CRISPR)
KN518163 1 Kit

Trem3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT5A (NM_003392) Human Over-expression Lysate
LC401155 20 µg

WNT5A (NM_003392) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse 4930480K23Rik activation kit by CRISPRa
GA210070 1 Kit

Mouse 4930480K23Rik activation kit by CRISPRa

Sign In for Pricing
View Details
BCMA (TNFRSF17) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H5]
TA814060BM 100 µL

BCMA (TNFRSF17) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H5]

Sign In for Pricing
View Details
EXOC2 Rabbit Monoclonal Antibody
TA423441 100 µL

EXOC2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
NUFIP1 Human Gene Knockout Kit (CRISPR)
KN415727 1 Kit

NUFIP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details