Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDKRB2 Rabbit Polyclonal Antibody (FITC)

BDKRB2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

B2R, BK2, BK-2, BKR2, BRB2

UniProt

P30411

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BDKRB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_000614

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-hsa-miR-4281-Off Virus
mh5780 1.0 mL

AdmiRa-hsa-miR-4281-Off Virus

Sign In for Pricing
View Details
Mouse IgG2a isotype control-InVivo
A2117-5mg*5 5x 5mg

Mouse IgG2a isotype control-InVivo

Sign In for Pricing
View Details
RFXAP, CT (RFXAP, Regulatory factor X-associated protein, RFX DNA-binding complex 36kD subunit) (Azide free) (HRP) discontinued
040991-HRP 200 µL

RFXAP, CT (RFXAP, Regulatory factor X-associated protein, RFX DNA-binding complex 36kD subunit) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
GPR77, CT (GPR77, C5L2, C5a anaphylatoxin chemotactic receptor C5L2, G-protein coupled receptor 77) (MaxLight 550) discontinued
036251-ML550 100 µL

GPR77, CT (GPR77, C5L2, C5a anaphylatoxin chemotactic receptor C5L2, G-protein coupled receptor 77) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Tmem175 ORF Vector (Mouse) (pORF)
ORF059812 1.0 µg DNA

Tmem175 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
MEK-4 (Phospho-Ser80) Polyclonal Conjugated Antibody
MBS9437613-01 0.1 mL (Biotin)

MEK-4 (Phospho-Ser80) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details