Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADH1B Rabbit Polyclonal Antibody (Biotin)

ADH1B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ADH2, HEL-S-117

UniProt

P00325

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ADH1B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000659

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALCRL Polyclonal Antibody, HRP Conjugated
bs-1860R-HRP 100 µL

CALCRL Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Lentiviral human NIPAL3 sgRNA gene knockout kit - Lentiviral human NIPAL3 sgRNA gene knockout kit (25)
GTR15400701 1 Vial

Lentiviral human NIPAL3 sgRNA gene knockout kit - Lentiviral human NIPAL3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Wdr38 Mouse qPCR Primer Pair (NM_029687)
MP218475 200 Reactions

Wdr38 Mouse qPCR Primer Pair (NM_029687)

Sign In for Pricing
View Details
PRDM12 Rabbit Polyclonal Antibody (FITC)
orb2137420 100 µL

PRDM12 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Human LIPC-Lipase, Hepatic- ELISA Kit
E-EL-H0478-01 24 Tests

Human LIPC-Lipase, Hepatic- ELISA Kit

Sign In for Pricing
View Details
Human LIPC-Lipase, Hepatic- ELISA Kit
E-EL-H0478-02 48 Tests

Human LIPC-Lipase, Hepatic- ELISA Kit

Sign In for Pricing
View Details