Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADH1B Rabbit Polyclonal Antibody (FITC)

ADH1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ADH2, HEL-S-117

UniProt

P00325

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ADH1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000659

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETV6 / Tel Rabbit Polyclonal Antibody (BF350)
orb2527791 100 µL

ETV6 / Tel Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Cullin 4B (CUL4B) Rabbit Polyclonal Antibody
TA375232 100 µL

Cullin 4B (CUL4B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD54 Protein Vector (Human) (pPB-His-GST)
PV322187 500 ng

ANKRD54 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 19 Like Protein (TNFRSF19L) Antibody Pair Kit (with Standard)
MBS2102864-01 5x 96 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 19 Like Protein (TNFRSF19L) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 19 Like Protein (TNFRSF19L) Antibody Pair Kit (with Standard)
MBS2102864-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 19 Like Protein (TNFRSF19L) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily, Member 19 Like Protein (TNFRSF19L) Antibody Pair Kit (with Standard)
MBS2102864-03 10x 96 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily, Member 19 Like Protein (TNFRSF19L) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details