Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADH1B Rabbit Polyclonal Antibody (HRP)

ADH1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADH2, HEL-S-117

UniProt

P00325

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ADH1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_000659

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R14B polyclonal antibody
BS72670-01 50 µL

PPP1R14B polyclonal antibody

Sign In for Pricing
View Details
PPP1R14B polyclonal antibody
BS72670-02 100 µL

PPP1R14B polyclonal antibody

Sign In for Pricing
View Details
2,4-Dimethylthiazole-5-carboxylic Acid
DCA13727 50 g

2,4-Dimethylthiazole-5-carboxylic Acid

Sign In for Pricing
View Details
Rab11A (RAB11A Member RAS Oncogene Family, Rab-11A, MGC1490, RAB11, Rab-11, Ras-related Protein Rab-11A, Ras-related protein Rab11A, YL8) (MaxLight 405) discontinued
R0009-ML405 100 µL

Rab11A (RAB11A Member RAS Oncogene Family, Rab-11A, MGC1490, RAB11, Rab-11, Ras-related Protein Rab-11A, Ras-related protein Rab11A, YL8) (MaxLight 405) discontinued

Sign In for Pricing
View Details
2- (2,5-Dimethylmorpholin-4-yl) ethan-1-amine
RYB01213-01 50 mg

2- (2,5-Dimethylmorpholin-4-yl) ethan-1-amine

Sign In for Pricing
View Details
2- (2,5-Dimethylmorpholin-4-yl) ethan-1-amine
RYB01213-02 0.5 g

2- (2,5-Dimethylmorpholin-4-yl) ethan-1-amine

Sign In for Pricing
View Details