Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Adh7 Rabbit Polyclonal Antibody (FITC)

Adh7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Adh, Adh-, Adh3, Adh4, Adt-, Adh-3, Adh3-, Adt-1, Adh-3e, Adh-3t, Adh3-e, Adh3-t, AI325182

UniProt

Q64437

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Adh7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_033756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf28 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-15189R-PE-Cy5.5 100 µL

C4orf28 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
α-dystroglycan (2237E2D1)
sc-65628 200 µg/mL

α-dystroglycan (2237E2D1)

Sign In for Pricing
View Details
ALDH1L2, CT (ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, Aldehyde dehydrogenase family 1 member L2) (MaxLight 550)
MBS6272758-01 0.1 mL

ALDH1L2, CT (ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, Aldehyde dehydrogenase family 1 member L2) (MaxLight 550)

Sign In for Pricing
View Details
ALDH1L2, CT (ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, Aldehyde dehydrogenase family 1 member L2) (MaxLight 550)
MBS6272758-02 5x 0.1 mL

ALDH1L2, CT (ALDH1L2, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, Aldehyde dehydrogenase family 1 member L2) (MaxLight 550)

Sign In for Pricing
View Details
Human ATP synthase subunit gamma, mitochondrial (ATP5C1) ELISA Kit
GTR10348504 96 Well

Human ATP synthase subunit gamma, mitochondrial (ATP5C1) ELISA Kit

Sign In for Pricing
View Details
PMP70 Rabbit Monoclonal Antibody
E46F2043 40 µL

PMP70 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details